NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209068_10000584

Scaffold Ga0209068_10000584


Overview

Basic Information
Taxon OID3300027894 Open in IMG/M
Scaffold IDGa0209068_10000584 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19650
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (86.96%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NamePennsylvania, USA
CoordinatesLat. (o)41.1289Long. (o)-78.4195Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006672Metagenome / Metatranscriptome367Y
F015403Metagenome / Metatranscriptome255Y
F018460Metagenome / Metatranscriptome235Y

Sequences

Protein IDFamilyRBSSequence
Ga0209068_1000058411F018460GGAGGMLRRLIPVFTLCLLTFPALCQSASKWQIATITEVKPHPAAGEDASDPITYDVSVKVGDTIYLVRYTTPAGEIAPKYAAGREILVLVGKNTITYNDILGRSLPVPIESHRLATEPKHSN
Ga0209068_1000058414F015403AGGAGGMKSRQILIAIVILGTVWHTAAAQPKKEIEVGAPPPEGIMAVTSMQSNPVLADLIALKPEMPSGPPDVLKSYELAMGMLADKTSVDCFVIVQAQQKNQLPANRRNIFCSRATKRQ
Ga0209068_100005849F006672AGGAGMKTLDTLPGESNTSITSSIINSVCPQCGGRMSAFECEGRCGRNWLAEWEWANQSTRSPKSRRGHAGRSML
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.