Scaffold Ga0209254_10005578

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209254_10005578

Scaffold Ga0209254_10005578

Overview

Basic Information
Taxon OID	3300027897 Open in IMG/M
Scaffold ID	Ga0209254_10005578 Open in IMG/M
Source Dataset Name	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11581
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (62.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment → Freshwater Lake Sediment Microbial Communities From The University Of Notre Dame, Usa, Of Lakes That Contribute To Methane Emissions

Source Dataset Sampling Location
Location Name	University of Notre Dame, Indiana, USA
Coordinates	Lat. (^o)	41.7	Long. (^o)	-86.23	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032323	Metagenome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209254_100055785	F032323	GAGG	MSYFVLRVKNDMELKARVLYAILSEKPSYSVKDYKEEPDPADNNYHIISLTAYEKGPYRHIRKILGEFIKNNEIECLNGLSSDLV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.