NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209067_10153889

Scaffold Ga0209067_10153889


Overview

Basic Information
Taxon OID3300027898 Open in IMG/M
Scaffold IDGa0209067_10153889 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1221
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NamePennsylvania, USA
CoordinatesLat. (o)41.1289Long. (o)-78.4195Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001473Metagenome / Metatranscriptome688Y
F005213Metagenome / Metatranscriptome408N
F019896Metagenome / Metatranscriptome227Y
F036729Metagenome / Metatranscriptome169N

Sequences

Protein IDFamilyRBSSequence
Ga0209067_101538891F019896N/ARAGPPAVVSLTGLKFDRSLWTFQNAQLGMEYASRLKTYNAPIPVKITQCEPGVAEVGPGEARIGLIALQLPPVNPDAKKTQPTVLKILFPIDRAGNLTATLVL
Ga0209067_101538892F001473GGAGMESEYQTVGQMYERLRLMIRQRNDTGFRLTVTDAVLEPRNPFEPANKRRPKSVVAITLVLAFVLALIFLYFSFHHAR
Ga0209067_101538893F005213AGGAGMASSATKMANGPEGTGEERQPDIQPQDVLFSALASSVCYWITVILLAIVGAYLIHWWLTHPGPYAAPANDPWGITTPPWLILPLAPIGVVGSLGHAIWGALRGQRTWKMLITAATLVAVMGCSKLLEIYLAPM
Ga0209067_101538894F036729GAGGMIQHSENSRREMTNSEAGVVGAVLGFGLIALLLYLAVARYHIRKEQLVEAGLYLFV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.