NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209048_10000489

Scaffold Ga0209048_10000489


Overview

Basic Information
Taxon OID3300027902 Open in IMG/M
Scaffold IDGa0209048_10000489 Open in IMG/M
Source Dataset NameFreshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)42320
Total Scaffold Genes42 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (59.52%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment → Freshwater Lake Sediment Microbial Communities From The University Of Notre Dame, Usa, Of Lakes That Contribute To Methane Emissions

Source Dataset Sampling Location
Location NameUniversity of Notre Dame, Indiana, USA
CoordinatesLat. (o)41.7Long. (o)-86.23Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002465Metagenome / Metatranscriptome557Y
F006066Metagenome / Metatranscriptome382Y
F016286Metagenome / Metatranscriptome248Y

Sequences

Protein IDFamilyRBSSequence
Ga0209048_1000048914F002465GGAGMPTNKPPKPDPLQNLTPRRIAEFALEESRLSNVAYRFQLVPRDRVWKNWDRTEFEPNHYKVVALAGVCLEREEVEKAHRTASRALEEIDGILFVVEEPADSIVVRGATGTMEFVRTPTLCAEIMAGSSAAFDRALAALEAAFPGERVAGKIVSEGRS
Ga0209048_1000048923F006066N/AMRRRPGEAPATHRVWVSQDQPLREAPGADGKLYFRIRLEGEPSPEWMRAYRAGLLGLVPEDRDVVMRFEFLGDSVRFAATDAEVGKIRRVLEKRVEAVNGILSGGRSIGS
Ga0209048_1000048931F016286GGAGGVSRDGYRAILSFSKDERFEVAVRGEWKRVEARMDGAPLIKIMRPDLKRVWQIRPTTKKILDAPWTPTDEIVPGYPLEPNFDPQAYADRFGGAIRQIGDDSHGLHPCDRWQMTLPSGDLVTLWVARDLEKLVVKIEHAKKDQSDEYQPFTVIELLDVRVGAASDLFEKPKGYTEVKTYQDLLG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.