NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209737_10947317

Scaffold Ga0209737_10947317


Overview

Basic Information
Taxon OID3300027904 Open in IMG/M
Scaffold IDGa0209737_10947317 Open in IMG/M
Source Dataset NameCubitermes ugandensis P3 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)834
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location
Location NameKakamega Forest, Kenya
CoordinatesLat. (o)0.2917Long. (o)34.856Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044786Metagenome154Y

Sequences

Protein IDFamilyRBSSequence
Ga0209737_109473171F044786N/ALVRRTRHTHTTGPKITLPNTDYAHKNITSNFGQARSTLPEDGSQMIRNMSEFLIVF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.