NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209415_10001556

Scaffold Ga0209415_10001556


Overview

Basic Information
Taxon OID3300027905 Open in IMG/M
Scaffold IDGa0209415_10001556 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)43957
Total Scaffold Genes45 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)36 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.13Long. (o)11.88Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001329Metagenome / Metatranscriptome721Y
F003353Metagenome / Metatranscriptome492Y

Sequences

Protein IDFamilyRBSSequence
Ga0209415_100015563F003353GGAMKATLRLTLELILIWTIISTAFAAPIGIYQHGTVVRMRMGDCTLTHRGFMNQFGPPQAVAIEESCPEYTLVTDKVVFLIVGKSSNQLVPLAEVIDFRLQNKELAVRVDDARKESKFVIKEMTLRSEWELIQKHIEDRLKEPPRQPVDTSLALRSRE
Ga0209415_100015565F001329AGGAGMAQNHYTTKTKRRPKNSNRKDPSAATMAALRKLEAAGKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.