NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209415_10004381

Scaffold Ga0209415_10004381


Overview

Basic Information
Taxon OID3300027905 Open in IMG/M
Scaffold IDGa0209415_10004381 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)25865
Total Scaffold Genes32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)24 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.13Long. (o)11.88Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013914Metagenome / Metatranscriptome267Y
F016557Metagenome / Metatranscriptome246Y
F082985Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0209415_1000438112F016557N/AMAKFKSAGTKKTSEKVKSARAAIPCLVLVALGIALMCVLFYFSLQSGLPQ
Ga0209415_100043814F013914GGAGGVGNQILDEERTLARLQTLMRSEHWLATYVSDLLSAHDLSAGIDFRTAEQLLAAEKEQFEKDLAIARRMLRVYGKQVMAENLSQSAYAPNNG
Ga0209415_100043815F082985GAGMTIDARELNEFTRKATELMSETAEVPRVLRNRLGDQHQLVHAAEEMQGSIERFVRELRCFDVSAQTVDADTFGGS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.