NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209404_10046160

Scaffold Ga0209404_10046160


Overview

Basic Information
Taxon OID3300027906 Open in IMG/M
Scaffold IDGa0209404_10046160 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2455
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (20.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameTropical Atlantic Ocean
CoordinatesLat. (o)15.249Long. (o)-20.515Alt. (m)Depth (m)55
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046070Metagenome / Metatranscriptome152N
F048244Metagenome / Metatranscriptome148Y
F090610Metagenome / Metatranscriptome108N
F101084Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0209404_1004616012F048244N/AMKVELTQKEIDRIYFDLKNYVKTTYYVDRLNELSESDKEECKIELDLIEKFSKL
Ga0209404_100461606F046070GGAMKRIKELRKVAQDAQTKMDLISKRIMQGGLSLDQQILHLDNFAKNQTRHMLGNEELYKLLKNK
Ga0209404_100461607F090610AGAAGMHKVWRLYLIDNKSITEISKELNITKSKLQTQYGIK
Ga0209404_100461608F101084N/AMNRDDLVYDFNDEMWNLYHEGTIDNEDDFYDQKNIWIDNQVIYTYECKKICDALDYDIFEEHDIFGKANNWSQAAYCAIYDLLNEHNDALNYDEMKLQEEEANA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.