NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209404_10208189

Scaffold Ga0209404_10208189


Overview

Basic Information
Taxon OID3300027906 Open in IMG/M
Scaffold IDGa0209404_10208189 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1216
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameTropical Atlantic Ocean
CoordinatesLat. (o)15.249Long. (o)-20.515Alt. (m)Depth (m)55
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000302Metagenome / Metatranscriptome1337Y
F023710Metagenome / Metatranscriptome209Y
F037814Metagenome / Metatranscriptome167N

Sequences

Protein IDFamilyRBSSequence
Ga0209404_102081892F000302AGGAGMIKTMTQEKKDQIRDLEGQKIILEDRLEHLGYSGNLVKMHKIEEEIFEIEDTIAKLTA
Ga0209404_102081893F023710N/AMQKTIEKKLESFVRAELSGIVQRIEMVNGSMFLMLDKPADCDFVHKEIRTFYKENINPEGGVNMYFVGDEFAFDFVPEDREAPVFMKEDEEAEVEAQAEIQMSLDNDATEGR
Ga0209404_102081894F037814GGAGGMEISLGISIFMLLVIIVSCLWMLKELKECQKIIKKMQRRSKKYIREVVSND
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.