Basic Information | |
---|---|
Taxon OID | 3300027909 Open in IMG/M |
Scaffold ID | Ga0209382_11350354 Open in IMG/M |
Source Dataset Name | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 719 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Tennessee | |||||||
Coordinates | Lat. (o) | 35.8443 | Long. (o) | -83.9607 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004384 | Metagenome / Metatranscriptome | 440 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209382_113503542 | F004384 | AGGAG | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARREWQRPRPAA |
⦗Top⦘ |