NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209583_10067872

Scaffold Ga0209583_10067872


Overview

Basic Information
Taxon OID3300027910 Open in IMG/M
Scaffold IDGa0209583_10067872 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1300
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NameUSA: Pennsylvania
CoordinatesLat. (o)41.5935Long. (o)-78.5142Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000696Metagenome / Metatranscriptome931Y
F000739Metagenome / Metatranscriptome913Y

Sequences

Protein IDFamilyRBSSequence
Ga0209583_100678721F000739N/AGRFGARVSQAAVCYWCHEDMTRLQIWLRGIFAAAISGAAGGVLTGFAAVGIDPQHFNLQSGTGATLRIGAAAAFINAVIGVAAYLQKSPLPEEGK
Ga0209583_100678722F000696AGGAMPVVGSSAYNTAGQITALVRSLLNDSQGNLFTDAILLPYANSAYRKLQRALGNAGAGGFIQDDALLVVTAVTQVDPSVQVSLSDATAPPNQLPTDLLAPLKLWERPNGSAQDFVEMVDLTRHGGLPSRPQDSTLSVWEWRADGIYFLGATQDTQIRLRYVKAYPDFTDATSPVLVRNAQEAIAYATAALAGWARGSPLAEKWDEAASDALEDLVAAAVRREQQSARRRRPFSARSGYTPF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.