NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209698_10007108

Scaffold Ga0209698_10007108


Overview

Basic Information
Taxon OID3300027911 Open in IMG/M
Scaffold IDGa0209698_10007108 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11794
Total Scaffold Genes22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (77.27%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Clearfield County
CoordinatesLat. (o)41.170727Long. (o)-78.4726Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000042Metagenome / Metatranscriptome3762Y
F005828Metagenome / Metatranscriptome389Y
F010187Metagenome / Metatranscriptome307Y
F011787Metagenome / Metatranscriptome287Y

Sequences

Protein IDFamilyRBSSequence
Ga0209698_1000710811F000042AGCAGMKNIKFVVRVSRGVTRAAEYVKRIDRSPIQMTTHRSLALVMGRFTAEDAVKSIQNSRRSPELVPVLVGAA
Ga0209698_1000710815F010187GGAGGMHPEDLLKPDLFSGMVLLGSGGLIFVSLLLIVVSALTRA
Ga0209698_100071085F011787AGGAGMKPLPLIGVLLLLVGLLCFVVPIPHRESHGVKIGDTKIGVQTENSEKLPPAVGIVFLAGGVLCLVLGSRRA
Ga0209698_100071089F005828N/AVERLGTAENCLVCKDLERALESRLSGYMQACSAAYYRVSTELAANKNVDMERAKSDLEEHRLVCVFAASLKLGSELGS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.