NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209536_100560234

Scaffold Ga0209536_100560234


Overview

Basic Information
Taxon OID3300027917 Open in IMG/M
Scaffold IDGa0209536_100560234 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1424
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location NameWhite Oak River estuary, North Carolina, USA
CoordinatesLat. (o)34.640199Long. (o)-77.109447Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001915Metagenome / Metatranscriptome617Y
F012670Metagenome / Metatranscriptome278Y
F099270Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0209536_1005602341F099270GGAMTTNFQFAQAPNRKGNISKHAPSKSGGATNVTGAAHGTATPKGNQGAPKANGNVYPVGNKVSVSTHADYCGTIKNDGYLKN
Ga0209536_1005602343F012670AGGMTDIFGEIRPEGAPVTTEKQRQHSKAQYAQKKAMKIATGQRDPRDTLSDNPQNRNTKGRPKSIVNRVTEYGALFNSLNEERLKKGLSPLRTAMDVLIEAMNSDELELKEKAKIAEKLATFESSRAPIISIEHVQNISKEEEVTADEALDDFLQSLRKV
Ga0209536_1005602344F001915N/AWYKIFSPKTFDCIAMEWTLAHPLHDVEDMVLLADQVYGQEVDGILKRDRAVFRKNLTIATTVQVFDKGREFIAVCRNIPVPFGDNGLLGYCWFDRGGYTTYSSEEISNAKFHHLDLSLPAKQRVRMINEMIDQHILWAYTWNIPIICSTSIRSEHDGFMRIHKKRGFMVNGSYAWIRTEEGMKGLK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.