Scaffold Ga0209749_1000183

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209749_1000183

Scaffold Ga0209749_1000183

Overview

Basic Information
Taxon OID	3300027958 Open in IMG/M
Scaffold ID	Ga0209749_1000183 Open in IMG/M
Source Dataset Name	Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-47 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	102844
Total Scaffold Genes	115 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	99 (86.09%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico

Source Dataset Sampling Location
Location Name	Espanola, New Mexico, United States
Coordinates	Lat. (^o)	35.992	Long. (^o)	-106.0797	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016758	Metagenome / Metatranscriptome	245	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209749_100018363	F016758	GGAGG	MNVKGIIYNTGKTTIIKVFGEDRWNAFVPKLTAKDKFFSNIIMSVTPIPLDKFILFLDELVKEFFNNDMTQYMTFGKLAAQFTLSPEGQYKSYMLTKDTKRFVESVMPKLWEAYFDEGAVITKFENNVVHLKITGLPFKHRYFEHLIMGFFQKSLKIFGKKNVPKQVRSLASGDKDIYFQFELKDS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.