NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209400_1033096

Scaffold Ga0209400_1033096


Overview

Basic Information
Taxon OID3300027963 Open in IMG/M
Scaffold IDGa0209400_1033096 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2850
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (58.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026209Metagenome / Metatranscriptome198Y
F047479Metagenome / Metatranscriptome149N
F080837Metagenome / Metatranscriptome114N
F102437Metagenome / Metatranscriptome101N

Sequences

Protein IDFamilyRBSSequence
Ga0209400_10330961F102437AGGAGMTSKLRAFEDTVLSVREPRELKGSLVCSIQDSDIPITDKRKLIIAIDRCNTINDLQRLFYNDL
Ga0209400_103309610F047479AGGAGMKNKLYLQIDLYNGKSKWITKKDFLLFTVGDEYDGKDSRGYYMNYKLHDGTIEKEYYNWKDNWESIKKTNTHTVYKGEECMLIDFSNKGTK
Ga0209400_10330962F026209N/AMNKEVTNEIYDDNTGEWRKVTVPAIGGIKWHKREQLGDQKQSAYYDHSFYKVPFYGPYDQGRIRNALNKMYPARFNKFGGYTTVSTVEQLDDQHIKVELCYHIGD
Ga0209400_10330964F080837N/AMMKTKAKQKHEFFPKMMTTQVLKPYLKEAKRVGYTVSGSVKDGFIAVVTDACEQHPAGEVVMRGVKKPGVNVWIMGFNTLYWQEPTIAECLAESKWYAEMEGASK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.