NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209298_10011139

Scaffold Ga0209298_10011139


Overview

Basic Information
Taxon OID3300027973 Open in IMG/M
Scaffold IDGa0209298_10011139 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4784
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (88.24%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055683Metagenome / Metatranscriptome138N
F064669Metagenome / Metatranscriptome128N
F082597Metagenome / Metatranscriptome113N
F099193Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0209298_1001113914F099193GGAGGMYIMMDESRLKREFTEENLTAWAEYRAECHRANYYFKRDGWSEGTLFDWDPEKKECTLQLRWGDDQNNQENYCHYEDLDEQEYLRQYDEYVLSVKLTDLVS
Ga0209298_1001113915F064669AGAAGGMANSRALHPVEQWVQHITKTTPDLILGTLQHADLEMAQQLSNQMQLRGLSMQDIERLKNRKQPVSTT
Ga0209298_1001113916F055683AGGAGMAQLNTTQDILQYAKAQSGITQQESVGGSLYCEMIDADQAEWFRKDLQEKVNSNTEVKMYALGKGINRDRQEYVYDFVPKTQTEIPAEVEQMIELEAEIQRGK
Ga0209298_100111392F082597AGGMSLSTYWHDLIEFKTEHAPFTVKVDYTYEEEPLESLFPEESAEWYKETARKVERSDMPYVIVRAKVFLDGVPLADNNLGGMLFDSWEELELSMTQDDHGLIAETVQEARDQWDRLQQLMSTQPKVVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.