NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209702_10003111

Scaffold Ga0209702_10003111


Overview

Basic Information
Taxon OID3300027976 Open in IMG/M
Scaffold IDGa0209702_10003111 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)27010
Total Scaffold Genes50 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)38 (76.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location
Location NameLake Fryxell, Antarctica
CoordinatesLat. (o)-77.605Long. (o)163.163Alt. (m)Depth (m)18
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003439Metagenome / Metatranscriptome486Y
F016801Metagenome / Metatranscriptome244Y
F070899Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0209702_1000311116F016801GGAMTTLVAVQGDGWTVIGCDSRASDEDGRFMELATSKIVDNNGVLLAVSGASRGGNITQFGWKPPKPRVNEDLDVFMTKKFIPSMRKAFIAAGYDAKDDGDAAWQDSNLIVSIRGVIYPVFNDYSWDREERGIYYSGSGGDVALGALEALDYRKAKSPEGVEKLIRKAIEIACKHDIYSGGEIHTHIQYE
Ga0209702_1000311122F003439AGGMTVRVARSQNAEMNEGATDGKYRKRRPNTTVAAGMGDQEVVKNRSGLHPYMNYGFINSEEANKVNPLG
Ga0209702_1000311123F070899N/AMVKDPGLLTDSTGDGMAGAIDLSLETQQNLKKTYYNGSKPCTECGLAMNPVEAMHSTGLCPNCKRRKSTKLVKGRMI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.