NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209168_10000082

Scaffold Ga0209168_10000082


Overview

Basic Information
Taxon OID3300027986 Open in IMG/M
Scaffold IDGa0209168_10000082 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)107793
Total Scaffold Genes94 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)79 (84.04%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000036Metagenome / Metatranscriptome4352Y
F000228Metagenome / Metatranscriptome1519Y
F002835Metagenome / Metatranscriptome527Y
F007331Metagenome / Metatranscriptome353Y

Sequences

Protein IDFamilyRBSSequence
Ga0209168_1000008216F000036AGGMAYKETFWMACDSTEQLRAEYGPFHTRTEAETEAKKLGFGYLLRYEHLLGPQEEIEEVRCIFVELPGAAPVGIDVNSVTLHTRCATCGESAAHDTGWRAEVWADIHEFEHSRHLVRLFEHARGKGLKEICDWRG
Ga0209168_1000008239F002835GGAGGMRTAFPPCPNRWKTLYNTAILETNQALLPQRVSEAEEAVRARGREIFYGNGTPEEEALDDARYALHAFRTAWQHSNAVRLRIVR
Ga0209168_1000008240F007331GAGMSTIEEVRAAEKKVQKVLDALKKADARDTADLSAELTKATDEYAKAVRELRSE
Ga0209168_1000008246F000228N/AMFLIPCSCGRTFAVAENYDHQGTAWSRYIVCPGCGKRHDPKNRLLQMGFHSEGYWKVDEC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.