NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209168_10001334

Scaffold Ga0209168_10001334


Overview

Basic Information
Taxon OID3300027986 Open in IMG/M
Scaffold IDGa0209168_10001334 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19707
Total Scaffold Genes22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (68.18%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005605Metagenome / Metatranscriptome395Y
F052841Metagenome / Metatranscriptome142Y
F082787Metagenome / Metatranscriptome113N

Sequences

Protein IDFamilyRBSSequence
Ga0209168_1000133414F052841GGAGVKLSQKFFHTISQKFSDKKARRWFWAGLAAFVALQIYFVQEMVAALILFTGVFVLIALIALVLYVVDQGAKWSIEWASEHATPAVQLLRRGWTLAEELSKKPFRRPRSETAQ
Ga0209168_100013344F082787AGGAGMALHNVGQMGAVGEIMALFGLAILWTFRAQAFEWLREFLDIWRGQISGHDPLLSDPVYNRVKPRRPRGALLLVGALALVFIGQVLFLIDITF
Ga0209168_100013349F005605N/AVATQSIGLYAAARHFLRVLWKAARELFHEVTGALFFLIAFAGIQSAWRAWQRGSGQWLIGVSAGYALLMIFFGVLSFRDSRRVR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.