NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256381_1000744

Scaffold Ga0256381_1000744


Overview

Basic Information
Taxon OID3300028018 Open in IMG/M
Scaffold IDGa0256381_1000744 Open in IMG/M
Source Dataset NameSeawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3894
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)34.0321Long. (o)27.821Alt. (m)Depth (m)1600
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004651Metagenome / Metatranscriptome429Y
F005219Metagenome / Metatranscriptome408Y
F032720Metagenome179Y

Sequences

Protein IDFamilyRBSSequence
Ga0256381_10007441F004651AGGAGMTTSETIENHYGAAHAHLSDDELLAEMEHIGAILDGFKNTLGHLEMEVYRRIEERGATSIPSETYICEMETGFKYDQPSFGPLKEVFNEVDLKKCLIPAHTEEVKVADKWATGTVKSLAVKYGAEALRILANAQTESRGRLKFARRETK
Ga0256381_10007447F005219GGAGGMTSGENEPIRPIFSTIRRTCPECGGAMTVELLRRDPHDTPVLFLVCPCGYWEAAPPDIEAEVQDRPRMPGF
Ga0256381_10007448F032720AGGAGGMIIPDYQVGQYVHLKPFQSGADGIRCVCNPDKESGLQAPAITAPELGGCWHGAATRVLRVFPDGDLLLENRHGFVRGARPDEVCR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.