 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300028018 Open in IMG/M |
| Scaffold ID | Ga0256381_1023336 Open in IMG/M |
| Source Dataset Name | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1008 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dadabacteria → Candidatus Dadabacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mediterranean Sea | |||||||
| Coordinates | Lat. (o) | 34.0321 | Long. (o) | 27.821 | Alt. (m) | Depth (m) | 1600 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005883 | Metagenome / Metatranscriptome | 387 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0256381_10233362 | F005883 | N/A | MLEQITNLGTNGMVYRRGQQIVLQNERTSEHVAVKVVMHDSRNGWLAENGEGDWQWYRMNNEYWPDQTDYWKYVKKVGT |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |