NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247723_1009380

Scaffold Ga0247723_1009380


Overview

Basic Information
Taxon OID3300028025 Open in IMG/M
Scaffold IDGa0247723_1009380 Open in IMG/M
Source Dataset NameSubsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3921
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6017Long. (o)-79.9761Alt. (m)Depth (m)2281
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000808Metagenome / Metatranscriptome882Y
F003393Metagenome / Metatranscriptome489Y
F005348Metagenome / Metatranscriptome403Y

Sequences

Protein IDFamilyRBSSequence
Ga0247723_100938013F003393GAGMIDLENDDTIVIMDYIKADILTSGQLMVDDCIRIGDEVVSIVDIVSLADGYTLEVVNDFGERDIIEVGEYDQFDLMILQ
Ga0247723_10093804F005348AGGMINSVMAFDCDECNGQGLIFWGNELDYDVEKCECNDFAIGNLFTSGEAN
Ga0247723_10093809F000808AGGAGMEYTYSLTTSYDGELIHTLRVSDMLEAVDAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGNVVIK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.