Scaffold Ga0247722_10000339

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247722_10000339

Scaffold Ga0247722_10000339

Overview

Basic Information
Taxon OID	3300028027 Open in IMG/M
Scaffold ID	Ga0247722_10000339 Open in IMG/M
Source Dataset Name	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	29851
Total Scaffold Genes	34 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (2.94%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location Name	USA: West Virginia
Coordinates	Lat. (^o)	39.6017	Long. (^o)	-79.9761	Alt. (m)		Depth (m)	2281
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085222	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247722_1000033932	F085222	N/A	MHKKYINKYGKFSHNLNIEIDESLSKDEKNIILYDIFNLINEKHIKKYILNNIDVSIKWRVYDKTDLLHYYTDSDGIFADRAINEHTKLLLNDINTIKNSDKFKIYLSKPLTKSICIM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.