NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247722_10005338

Scaffold Ga0247722_10005338


Overview

Basic Information
Taxon OID3300028027 Open in IMG/M
Scaffold IDGa0247722_10005338 Open in IMG/M
Source Dataset NameSubsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6009
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (68.42%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6017Long. (o)-79.9761Alt. (m)Depth (m)2281
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007525Metagenome / Metatranscriptome349Y
F030094Metagenome / Metatranscriptome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0247722_1000533814F007525GGAGMTNLTGVTVTYTEVIPTSKQMAEFYVWQEGYESYATIRYEDRVVEVERGGEMHLTLPYFINGELSDEGATVVRYSDDLEAAGINDDIQFMQYLKTISNSGFEVYRMNPWWEVFSHNEDMGEVYDTFYEAIDGGIDYILDDRNW
Ga0247722_1000533819F030094N/AFESVWSMEVPQTEWESFLRHHPDFDENDRDDIQEMWNHFKELGCYDEIDDTVDTDVIMTGIETYGVEVEIN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.