Scaffold Ga0247722_10066215

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247722_10066215

Scaffold Ga0247722_10066215

Overview

Basic Information
Taxon OID	3300028027 Open in IMG/M
Scaffold ID	Ga0247722_10066215 Open in IMG/M
Source Dataset Name	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1373
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location Name	USA: West Virginia
Coordinates	Lat. (^o)	39.6017	Long. (^o)	-79.9761	Alt. (m)		Depth (m)	2281
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030094	Metagenome / Metatranscriptome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247722_100662151	F030094	GGAG	MKLRGIFEGSFESVWSMEVPNDVWLSYLEQHPDFDENDRDDIQEMWDYFKSIGCYDEIDDTADTDVYMTGIE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.