NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247722_10068771

Scaffold Ga0247722_10068771


Overview

Basic Information
Taxon OID3300028027 Open in IMG/M
Scaffold IDGa0247722_10068771 Open in IMG/M
Source Dataset NameSubsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1342
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6017Long. (o)-79.9761Alt. (m)Depth (m)2281
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001460Metagenome / Metatranscriptome690Y
F001781Metagenome / Metatranscriptome635Y
F002387Metagenome / Metatranscriptome565Y
F007644Metagenome / Metatranscriptome347Y

Sequences

Protein IDFamilyRBSSequence
Ga0247722_100687711F001781GGAMKPDDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQNCSIDEMWDHLCEAVEAGQGFSLEYGAEQHQEEVLE
Ga0247722_100687713F007644GGAGGLTTQTKSSYFLEYMKIHLISLEQDLESNPESINVIDIPGQIEATRHLLSVATDIMNDNER
Ga0247722_100687714F001460GGAGMLGYTESDLNRMINAIHDVKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTD
Ga0247722_100687716F002387AGGAGGMASFLEDVNQMVIDAVYSEIADQLLDDWINSNLNEGQYYADKQFAIMSGDKFIFEQFNKFYELKEGDEDYLEFL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.