NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0268352_1001794

Scaffold Ga0268352_1001794


Overview

Basic Information
Taxon OID3300028057 Open in IMG/M
Scaffold IDGa0268352_1001794 Open in IMG/M
Source Dataset NamePhyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1751
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)42.39Long. (o)-85.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005257Metagenome / Metatranscriptome406Y
F012742Metagenome277Y

Sequences

Protein IDFamilyRBSSequence
Ga0268352_10017941F005257AGGMVPNAPKSYETHQNVSLGSNGVDRVHSLRKNPTRLRGTNFCTSTARFATSFVWQPNGPECTQIVRNTPKLQFRVQWGGSGLFVAKNSDATSWHKLLHLFGPFCSEFRKATKRSRMHPNSTKRTKTSVLGSMGWIGCVRCEKFRCDF
Ga0268352_10017942F012742N/AVHSGLFGCLTKLVAKLAELVQNFVPRSGVVIFRNECTRSTPLDTKLTFWSVSYYFCAFGIVWFPYKTRCKTGRTSAKVRATKSGGNFRNERTQSTPCDPKLIFWCVRAIWVHSGLFGCLTKLGAKWAELVQKFVPQSRVRIFHNESTRSTPLDPKLTFWFVSYYLGAFGTAWLSYKTRSKTGRSSAKFRATNSRRNFSQRMHPIHPIRP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.