 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300028091 Open in IMG/M |
| Scaffold ID | Ga0255184_1069606 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 679 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Louisiana | |||||||
| Coordinates | Lat. (o) | 29.8571 | Long. (o) | -89.9778 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000258 | Metagenome / Metatranscriptome | 1443 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0255184_10696061 | F000258 | GGAG | MTVNYKLDAMLELRKYLWAKLKAAGIFDESIYWSDNVGENIVPILPVQQYPEMNQFLSGKKHIIYDKIGVSYDTLWLICNEQILFTVYSTDVSEINEIRNFMIDEFRRMDDAAKDMNRHPGFNSDKFKIHTIYVADMSPTAPSEELQGFFSADIILEI |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |