NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256368_1083294

Scaffold Ga0256368_1083294


Overview

Basic Information
Taxon OID3300028125 Open in IMG/M
Scaffold IDGa0256368_1083294 Open in IMG/M
Source Dataset NameSea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)542
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Alaska
CoordinatesLat. (o)71.3731Long. (o)-156.5049Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062184Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0256368_10832942F062184GGAGMSSTFEEVKEQILNKYDVDFLCELLGITSESLVDRYEDLVMKNLDMFTEEDESSE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.