NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0268285_1033442

Scaffold Ga0268285_1033442


Overview

Basic Information
Taxon OID3300028167 Open in IMG/M
Scaffold IDGa0268285_1033442 Open in IMG/M
Source Dataset NameSaline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_120m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1347
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameCanada: Sakinaw lake, British Columbia
CoordinatesLat. (o)49.68Long. (o)-124.009Alt. (m)Depth (m)120
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008235Metagenome / Metatranscriptome336N
F040095Metagenome / Metatranscriptome162Y
F079785Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
Ga0268285_10334422F008235N/AMINYLKNLFKKPETTPVEQPKCEYYLAKYRANLSLSITYNLPDTNGYSYRQYDDVESDDNLVFLEQKDKKFKEYQEVISNINEQLKDNSSEYIIVNKSFLFKKSDFVNAKITIKDNW
Ga0268285_10334423F040095GGAGMKLYSRKNKEDLFDIFNIDISVPRIKYETQPGNTWGNDYPTKVIDIHFNTKFVYRKDITHWYFELTLLGFGFSITRQTGY
Ga0268285_10334425F079785N/AMKFRIWSKLANCYTHEPCYPGSSLHCASNYYLDTDGNIVDFITTIGGNQDDATKDTVNQEDYTIEEYTGLNDIKGNRIFEGDIVK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.