NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255193_1022183

Scaffold Ga0255193_1022183


Overview

Basic Information
Taxon OID3300028269 Open in IMG/M
Scaffold IDGa0255193_1022183 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)911
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Louisiana
CoordinatesLat. (o)29.8571Long. (o)-89.9778Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013762Metagenome / Metatranscriptome268Y
F091429Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0255193_10221831F091429AGGAGMAAKLNSEFNYRYQVMGDTVWEKIKHLQNFLVGRKRAEALEQVAELKFQAKKAELQHLKDSNALPHLILNLQAEIIEIESVQEDQKNNFSINKQEIRILEKLLDELFILAEPTRLKHPDGTPFTDEEMFEANAANEFTVMIGREIQAEIIANGRPSPAKLKNAMSNPYTFAALQQIG
Ga0255193_10221832F013762N/ADTTGVGTARYGLAAAEYGGDKSIFGYGYNNTSLHVSMTNLVSNTGTVATDTTGTGTARMNLAATLYGGDKAIFGYGYNGSIFLNMTNLVSNTGGVTTDTTGVGTAREGLAAASYN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.