Scaffold Ga0268262_10394040

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0268262_10394040

Scaffold Ga0268262_10394040

Overview

Basic Information
Taxon OID	3300028327 Open in IMG/M
Scaffold ID	Ga0268262_10394040 Open in IMG/M
Source Dataset Name	Nasutitermes corniger P3 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P3 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	654
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location
Location Name	laboratory colony in Florida, USA
Coordinates	Lat. (^o)	26.0625	Long. (^o)	-80.2332	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077442	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268262_103940401	F077442	N/A	TAFLRHSEQCLIHSPQTAFCFTNLSRLVLEIFRFFKKHAQNLNSPQNNSASWDLQMAFNLVA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.