Scaffold Ga0306873_108736

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0306873_108736

Scaffold Ga0306873_108736

Overview

Basic Information
Taxon OID	3300028347 Open in IMG/M
Scaffold ID	Ga0306873_108736 Open in IMG/M
Source Dataset Name	Saline lake microbial communities from Club lake, Antarctica - Metagenome #312 (v2)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1271
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Antarctica: Club lake
Coordinates	Lat. (^o)	-68.5417	Long. (^o)	78.2467	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030941	Metagenome	184	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0306873_1087364	F030941	N/A	RAQLHGGDAVVIALAVLCAFMALPSVLGLLVIFHVFVRSKNPPADTSNRINHFRLVWFALTREGLFVGLFPWLKNDEYDNVTKE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.