NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0306865_1008268

Scaffold Ga0306865_1008268


Overview

Basic Information
Taxon OID3300028375 Open in IMG/M
Scaffold IDGa0306865_1008268 Open in IMG/M
Source Dataset NameSaline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E5 #431 (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2643
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Rauer Islands
CoordinatesLat. (o)-68.5558Long. (o)78.1913Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017336Metagenome / Metatranscriptome241N
F065935Metagenome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0306865_10082682F065935AGGAMIDMKDMSNKLYWTLGYEAGVELERERIIRVFQAREANRTIMEALEYPYTAQELENTIREGQE
Ga0306865_10082685F017336GAGGMTRACVISHKSPMEANYGLLCAMCYDGLRSALQGAPSALQHLREIYVMRSPMELDTPKPLKKDPPAPFNLDAWQLAEDMWQALTGGYIPVKWNHIQVYGKAKEVCQALHQDIDNLVNRKEVIYLMPLVKTLGQALYRYPLEEKSRTTLLPCPSCNLKTVYSPPAEFGDDLQVKCHSCGFVIPPEKMAFYANLAERERA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.