NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0304729_1010369

Scaffold Ga0304729_1010369


Overview

Basic Information
Taxon OID3300028392 Open in IMG/M
Scaffold IDGa0304729_1010369 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4386
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014848Metagenome / Metatranscriptome259Y
F019477Metagenome / Metatranscriptome229Y
F041568Metagenome / Metatranscriptome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0304729_10103694F019477AGGAGMGHWEFGEFRIGRLFHCNGNDYIKQSTRTARMLSNGRIFYFGKNEVIHAIAY
Ga0304729_10103695F014848AGGAGMTRYYDELATYERNGFTIIVDKTYEDMHPRDSFDDSCHDIDEICKDIDRGHLEWFMLRVRVLVEGLELSSEYLGGCLYEDPKEILSDGTAEDIIDTVMTDAKKQVYRLSRKFAELSEQVDRETA
Ga0304729_10103697F041568AGGAGMFTTDNRRELHVALNTMYADRGAAFTSGYLNSMAQEMLYLLPKRKQKEFIRQVEAFNDRQLVTVKNCLTGKDVEIRRGDQGGPCDPSTERFHSM
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.