NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0268307_1000119

Scaffold Ga0268307_1000119


Overview

Basic Information
Taxon OID3300028470 Open in IMG/M
Scaffold IDGa0268307_1000119 Open in IMG/M
Source Dataset NamePhyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2440
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)42.39Long. (o)-85.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000661Metagenome / Metatranscriptome950Y
F038061Metagenome / Metatranscriptome166N

Sequences

Protein IDFamilyRBSSequence
Ga0268307_10001191F038061N/AAKRVNWCKSSCHDVALEFFAKNAPDPPHWAPNFCFHAICTILVHLGLFGCLTKLGAERAEPVQKVMPRSRIGSFRNESTRTNPLDPKLTFWCLSYYLGAFGTLWLPYNTQCKTGQTGVKVRATKSRWNFSNEHPRSTPLDPKLMFWCVSYYLGAFGTVWLCNNT
Ga0268307_10001192F000661AGTAGGLVGSQNLMENRQNWCECSCHEVALELFATNAPDPPHWTLNSCFGAFHTIWVHLGPFGCIKKLEAKRAKLVQKFVSRSHFGIFRNECTRSTPLDPKLMFWRVSYYFDAFGTVWLARKTRWKTGRTNAKVRSTKSRQNFSQRTHPIHPIGP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.