Basic Information | |
---|---|
Taxon OID | 3300028488 Open in IMG/M |
Scaffold ID | Ga0257113_1106321 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 866 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Northeast Subartic Pacific Ocean | |||||||
Coordinates | Lat. (o) | 50.0 | Long. (o) | -145.0 | Alt. (m) | Depth (m) | 1320 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006919 | Metagenome | 362 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0257113_11063211 | F006919 | GAG | MKSFIQHLREFASYSTSDLVFMNNGQGSASSGLMIPLSGPMFKRIWPDTIRTTVFHTTDLSGLEKLKRLEGGKKTISAFFSMMSKYMEGGIASGGGIVIEMEADVIVSARDDIMSQVDNKGRRWVEMSWFENQTRGGTGPKFAAVERELNDLIRSLVIKHLGPIMGQTEVRAAHEFGLWGDMKRHLKDSKKLSLVIKDYFDGVERIIKDNKEVMGDIFYSYAKSKRQTDNAWDEQVVNNIEITKVHIIDFTTKAPSLKGQFDATKDFAYV |
⦗Top⦘ |