NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137415_10000427

Scaffold Ga0137415_10000427


Overview

Basic Information
Taxon OID3300028536 Open in IMG/M
Scaffold IDGa0137415_10000427 Open in IMG/M
Source Dataset NameVadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)39859
Total Scaffold Genes41 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (65.85%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)39.7291Long. (o)-123.6419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016587Metagenome / Metatranscriptome246Y
F035890Metagenome / Metatranscriptome171Y

Sequences

Protein IDFamilyRBSSequence
Ga0137415_1000042718F035890GAGGMGRWPGCRGSAVVVVSAFIVLGASLAAQDKRAPPAPKTRYGSEYSGMYSFLKEGEFVQVTVEDAGRVTGFVSRYGDLDSDKGAFLDQFFKTGKLDGNTLTFTTQAVHGTVYEFTGTIGRGEGNKPGDEAYYVIKGTLKESQTDANKKTSSKSREVTLKAFPEAATPAARARD
Ga0137415_1000042728F016587N/AMSKAFVVALLAAACLVGCTKSSSPASTPHPDDAVQLKLKELAGSGAADCGRLDVRAPDQQLTSASSCATKSAQDKHPFFVAYDMPGMTTGVAGNAAGKLFAVELEGASPGAKLSSGPCPAEMRIAKSGRLTCFIPGTMGLNPTAADPHSGISTKPGGFPSGGFMPQPFPSTTNPNAAPKPPAKKQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.