NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255342_1004135

Scaffold Ga0255342_1004135


Overview

Basic Information
Taxon OID3300028567 Open in IMG/M
Scaffold IDGa0255342_1004135 Open in IMG/M
Source Dataset NameWastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyRestricted
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).


Scaffold Components
Scaffold Length (bps)15187
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes → unclassified Candidatus Cloacimonetes → Candidatus Cloacimonetes bacterium ADurb.Bin003(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location NameCanada: Vancouver, British Columbia
CoordinatesLat. (o)49.1150727Long. (o)-123.147Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047076Metagenome / Metatranscriptome150N
F077342Metagenome / Metatranscriptome117N
F082734Metagenome / Metatranscriptome113N

Sequences

Protein IDFamilyRBSSequence
Ga0255342_100413515F082734N/AMIMERRVSHRHLFGGQTITWQAFDEEEAKKRGISYSYWKDIHYSQETAEKVPFFVLSDDGIVVPIYSISFIRSGIVLRSAFGEFHLPNSGSRYYHDRAKMLVLTENRSQTEDYINYKSTPGALLRGAVVRMAANGLDVGEIVNILCVSPKSQRATKIKQFYKSEECTRMVREEVRKILENCGVTEEAVVKMLLEAREVALEKKDAANMLRAAENFVDMYGMKEKDRQIDTRTFEVESEVEDLKKLEKVSDRLKLTQKEEKDAQTN
Ga0255342_10041352F077342GGAGMARTLNEFIVSTGNYVYEITDAEMAGVDLTDFNVAVLLHCVLANELERDFIVFSKGSIDQVFDISKQYFLLDSPTYCRNAGNGIFIVSIPFWRMQHVAENLDSDIVSAEFEVVIYEFNTLEYPNGEDKGAASFQCIVIDTGTINFTKNRFPLPLTSVVDEPAEKQRREILNPKRIF
Ga0255342_10041355F047076AGGAGGMTNGELLALAQLIVPELTAKAFVQFYNIAFEKISREVRLLTPVLRPTSVSLYENLLEQNAVKIDSVKDASGDDIFWEVRHRKLLIYDSNKELITDATIGNHKLEIEYWVRISKAIKLSFPTDDDIESNPNIIEEWNEMIPGVEDTEVQLCALYLMITELAGIFPMEPGTVELYANKFSGAFQAVKTKYNSGNSPATITQVYF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.