NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247818_11267508

Scaffold Ga0247818_11267508


Overview

Basic Information
Taxon OID3300028589 Open in IMG/M
Scaffold IDGa0247818_11267508 Open in IMG/M
Source Dataset NameSoil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)528
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From Agricultural Site In Penn Yan, New York, United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.673Long. (o)-77.032Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088837Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0247818_112675082F088837N/AEGMLVVPPDTPHGFRNIGDVPLLLVSVHERGTLRQTWLGREPA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.