NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265306_10314291

Scaffold Ga0265306_10314291


Overview

Basic Information
Taxon OID3300028598 Open in IMG/M
Scaffold IDGa0265306_10314291 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)844
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameAtlantic Ocean: North Sea, Helgoland
CoordinatesLat. (o)54.1817Long. (o)7.9018Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087207Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0265306_103142911F087207AGGAMNRLLTGTVLTVLLSFQAQAAEPITREHIQEIVDMTDAATKNRDTAGIGEYLSETFQRVIEFTHNDKYTARVRIDKKKYLELIEEGWPTLEEYGYQREDTSIHIMPDGSSGQSYSTITETLSLRGTRMVSKYREHALYALEDGKPVITQISGHTLLGDTMREPEE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.