Scaffold Ga0265309_10006665

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0265309_10006665

Scaffold Ga0265309_10006665

Overview

Basic Information
Taxon OID	3300028599 Open in IMG/M
Scaffold ID	Ga0265309_10006665 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5494
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location Name	Atlantic Ocean: North Sea, Helgoland
Coordinates	Lat. (^o)	54.1817	Long. (^o)	7.9018	Alt. (m)		Depth (m)	8
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070135	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265309_100066655	F070135	N/A	NIPLDTNGQFKLQVYADGFAPTIQSFDEFSATNDVRMARAVECQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.