Basic Information | |
---|---|
Taxon OID | 3300028631 Open in IMG/M |
Scaffold ID | Ga0302241_1071476 Open in IMG/M |
Source Dataset Name | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Arg |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 780 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 44.11 | Long. (o) | -88.23 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F058970 | Metagenome / Metatranscriptome | 134 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0302241_10714761 | F058970 | N/A | DLVTKYTDLGFQEATASTIEYADGKLHLQKVFTNGATVDREVWEVGAFTSAGDCICRHVYLPYEVANNNTVSPGQTITIDIYIELIPDDDITYTLTESGSPTTHEYLLEGKIVVSATVGGDPIDPSSYTCERGKICFNGIVLPNAAPPVVTESRGGKIWKIRCATQDYTTVSRLITKQGLVNVGVSVTGYQYATSLQRYGTLKIWDKTNQTHTSYNNCLISGPVNVETFGLWYLFDLTIIQSYYGDL |
⦗Top⦘ |