NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0268299_1000022

Scaffold Ga0268299_1000022


Overview

Basic Information
Taxon OID3300028648 Open in IMG/M
Scaffold IDGa0268299_1000022 Open in IMG/M
Source Dataset NameActivated sludge microbial communities from bioreactor in Nijmegen, Gelderland, Netherland - NOB reactor
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)635753
Total Scaffold Genes517 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)401 (77.56%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Studying Microbial Cell-Cell Associations In A Wide Range Of Aquatic Ecosystems

Source Dataset Sampling Location
Location NameNetherlands: Nijmegen, Gelderland
CoordinatesLat. (o)51.82Long. (o)5.87Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019619Metagenome228Y
F026607Metagenome / Metatranscriptome197Y

Sequences

Protein IDFamilyRBSSequence
Ga0268299_100002221F019619GGAVGLAVEVSKQEVRVIDSLMDELATIVPSLREDDGYASVFVDEEPPDLLIESDDDGACPFLYRTKTSALCSIHSLALATGRSVPDVKPAACRHWPVMLERDGDDVRVTVQPHALKIGCVAPRRELPGKPSVLEAYREEIAEMCGGELPVRASRRADESRGADEARRADESRGAGDARRTRRARRDDAR
Ga0268299_1000022406F026607GAGGMKKSIVGITVAFALALSAAAASAGTYVTGALPSEFGGGFIPPDPAVLKNVQKASKEGAKLAASVEKCYSKGAANYSKGKATGVTACLNDLSKGVLIKYAAKIQNINQKAPGLPPCHNYAGDGVLIAGLVKGFNGLVYCQSPSGAFVDGSTSF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.