Scaffold Ga0268299_1068416

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0268299_1068416

Scaffold Ga0268299_1068416

Overview

Basic Information
Taxon OID	3300028648 Open in IMG/M
Scaffold ID	Ga0268299_1068416 Open in IMG/M
Source Dataset Name	Activated sludge microbial communities from bioreactor in Nijmegen, Gelderland, Netherland - NOB reactor
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1078
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Studying Microbial Cell-Cell Associations In A Wide Range Of Aquatic Ecosystems

Source Dataset Sampling Location
Location Name	Netherlands: Nijmegen, Gelderland
Coordinates	Lat. (^o)	51.82	Long. (^o)	5.87	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045837	Metagenome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268299_10684162	F045837	GGAGG	MPYRLRWEGHGVYRRFFGKVSSIEFRAAYVEMKDDLRYECTRYIISDYLEAEPGPDLTDTFVGRLEQLARLDYDCGPDIVHATVGSGEPMLAHVRSFESLPLAPYPEATFATVQDARRWIASNPRPAWRLAAPPCT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.