Basic Information | |
---|---|
Taxon OID | 3300028675 Open in IMG/M |
Scaffold ID | Ga0272445_1010181 Open in IMG/M |
Source Dataset Name | Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-003-1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4098 |
Total Scaffold Genes | 10 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (90.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wyoming | |||||||
Coordinates | Lat. (o) | 44.5775 | Long. (o) | -110.7896 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F086364 | Metagenome | 111 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0272445_10101818 | F086364 | AGGAG | MEREEIIAALEAAFAEISGAAYEDEPVTFAEFLKSFKEHRDPETPVYWIPWTVEEAVEALTGRNFGWHEDVFKDEWNYTGEFGFVCVDPTTLECLTAERTDDERCTVSVAFRILSIDDAVKVVEYFLQLAQA |
⦗Top⦘ |