NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307301_10019082

Scaffold Ga0307301_10019082


Overview

Basic Information
Taxon OID3300028719 Open in IMG/M
Scaffold IDGa0307301_10019082 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1995
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003951Metagenome / Metatranscriptome460Y
F074517Metagenome119N

Sequences

Protein IDFamilyRBSSequence
Ga0307301_100190823F074517GGAVPTPDRGLLARLDNLVELVADRHGLALLPDGRLAAAEARIAARATGLTAPRGSGGPAPGVTQREAVELLRAVGEGVGLLRVRADRLEATSLRHAWAQIDRGLRSGLVYAAWCHRVPWPAFLRGGPGVEALVGGRLWVLRLLLGLPAGVEVGLQGLVETVANALELDLDDWLPRAVAAAFLDPLVALGVADIRPPPPHPGSALRLGPRASTVIGSALVAAGEEVSLASTPAN
Ga0307301_100190824F003951GGAGGMGSNSRIDAGTAPTVWREVCDKCGTRMDLEGSAHGFERWSCPGCQQVVGIDRDPEVGTRFQIARGQPWNYAPEAFQR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.