Scaffold Ga0307317_10028770

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307317_10028770

Scaffold Ga0307317_10028770

Overview

Basic Information
Taxon OID	3300028720 Open in IMG/M
Scaffold ID	Ga0307317_10028770 Open in IMG/M
Source Dataset Name	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1728
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location Name	USA: Colorado
Coordinates	Lat. (^o)	38.9206	Long. (^o)	-106.9489	Alt. (m)		Depth (m)	20
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090528	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0307317_100287704	F090528	GGAGG	MNDSTLSYLRRLNPVPEAPSVDGAELFERITSLPRDERPAPRRSATRRRVALVAVGLAVMALLATTALAISGWFGDVVKPPVTRQE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.