NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302264_1000222

Scaffold Ga0302264_1000222


Overview

Basic Information
Taxon OID3300028732 Open in IMG/M
Scaffold IDGa0302264_1000222 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15010
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0469Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014032Metagenome / Metatranscriptome266Y
F025247Metagenome / Metatranscriptome202Y

Sequences

Protein IDFamilyRBSSequence
Ga0302264_100022212F014032GGCGGMEGIVALRSSPPPAHVSSETIVPDLRLRSAYRGIVTGRTMLRLRVVVAPRRQAAQEIIIEVDDLSVEVAGAGAGVVICAGAIDALFVVERQPRSGFLTWFGVFARRRGRPDRLLLETPDGPVARFVERAIEERLGLSDEPVRGELHVSR
Ga0302264_10002225F025247GGTGGMIHAVQELAEHDLSWLAIRYPAVMRLLERELTAPDGDALAAGLELACRVLGSRTPLGDLRLDHNTLNTAMVAVRSGRCDRAMVRSLRAQIDQLRVALTPREQDAVATVIAAIIWSVLDASSQALDDVLGA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.