NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302219_10001508

Scaffold Ga0302219_10001508


Overview

Basic Information
Taxon OID3300028747 Open in IMG/M
Scaffold IDGa0302219_10001508 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9637
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (72.73%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3535Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002101Metagenome / Metatranscriptome593Y
F004095Metagenome / Metatranscriptome453Y

Sequences

Protein IDFamilyRBSSequence
Ga0302219_100015081F004095AGGAGMSGINGDKARFNRRRRQKISRRISNQKMLKTLAEKHLAPPASPANQKENAA
Ga0302219_100015082F002101AGGAGMTAPVTALPLPNLDGNPARKKRVLLLDTSQTKRDLRADMMRKLGIDVDTAADVLEARCWWRADLYNLVLINVAGETDSRDKFCSDIRSANPSQRIAFFVGGPAYLAATPHSDAAPAESDADALHKEMVAALLAQSSENSSQRWGILEACKRISSVRSVSEARSRAIREAPRPSRWVEAGEQHPTPEAANPQPSFATAFATEREELL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.